PDB entry 1ld6

View 1ld6 on RCSB PDB site
Description: structure of bpti_8a mutant
Class: Hydrolase Inhibitor
Keywords: BPTI, Kunitz fold, Hydrolase Inhibitor
Deposited on 2002-04-08, released 2002-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (10)
      • engineered (12)
      • conflict (14)
      • engineered (16-18)
      • engineered (33)
      • engineered (36)
      • engineered (38)
      • conflict (51)
    Domains in SCOPe 2.08: d1ld6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ld6A (A:)
    rpdfcleppyagacraaaaryfynakaglcqtfaygacaakrnnfksaedclrtcgga