PDB entry 1lcy

View 1lcy on RCSB PDB site
Description: crystal structure of the mitochondrial serine protease htra2
Deposited on 2002-04-07, released 2002-05-22
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-29, with a file datestamp of 2002-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lcyA (A:)
    ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
    vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
    amgspfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnaggplvnldgevi
    gvntmkvtagisfaipsdrlreflhrgekknsssgisgsqrryigvmmltlspsilaelq
    lrepsfpdvqhgvlihkvilgspahraglrpgdvilaigeqmvqnaedvyeavrtqsqla
    vqirrgretltlyvtpevte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lcyA (A:)
    ppasprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnah
    vvadrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvv
    amgspfalqntitsgivssaqrpnveyiqtdaaidfgnaggplvnldgevigvntmkvta
    gisfaipsdrlreflhrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspa
    hraglrpgdvilaigeqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte