PDB entry 1lco

View 1lco on RCSB PDB site
Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate
Deposited on 1995-03-30, released 1995-09-15
The last revision prior to the SCOP 1.69 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.186
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lcoA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lcoA (A:)
    kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
    vidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldniinlydfe
    ylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdistdmlgshvd
    vpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiieaapsdkqiq
    wyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsalskfidpslt
    wkdieelkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaet
    mpileqrnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekai
    eilrdeiemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lcoB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lcoB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqrekdmklkqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda