PDB entry 1lcl

View 1lcl on RCSB PDB site
Description: charcot-leyden crystal protein
Class: serine esterase
Keywords: charcot-leyden crystal protein, serine esterase
Deposited on 1996-01-18, released 1997-01-11
The last revision prior to the SCOP 1.73 freeze date was dated 1997-01-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysophospholipase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lcla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lclA (A:)
    msllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgr
    rvvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpea
    vkmvqvwrdisltkfnvsylkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lclA (A:)
    sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
    vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
    kmvqvwrdisltkfnvsylkr