PDB entry 1lcl

View 1lcl on RCSB PDB site
Description: charcot-leyden crystal protein
Deposited on 1996-01-18, released 1997-01-11
The last revision prior to the SCOP 1.63 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1lcl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lcl_ (-)
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr