PDB entry 1lck

View 1lck on RCSB PDB site
Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa
Deposited on 1994-12-12, released 1995-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lckA (A:)
    dnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansl
    epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt