PDB entry 1lck

View 1lck on RCSB PDB site
Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa
Class: complex (kinase/peptide)
Keywords: complex (kinase/peptide)
Deposited on 1994-12-12, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p56==lck== tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lcka1, d1lcka2
  • Chain 'B':
    Compound: tail phosphopeptide tegq(phospho)yqpqpa
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1lckA (A:)
mgsnppasplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfi
pfnfvakanslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfd
qnqgevvkhykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

    Sequence, based on observed residues (ATOM records): (download) 
    >1lckA (A:)
dnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakansl
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

  • Chain 'B':
    No sequence available.