PDB entry 1lcj

View 1lcj on RCSB PDB site
Description: sh2 (src homology-2) domain of human p56-lck tyrosine kinase complexed with the 11 residue phosphotyrosyl peptide epqpyeeipiyl
Class: complex (kinase/peptide)
Keywords: complex (kinase/peptide)
Deposited on 1994-12-12, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p56==lck== tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lcja_
  • Chain 'B':
    Compound: phosphopeptide epq(phospho)yeeipiyl
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lcjA (A:)
    manslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgev
    vkhykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lcjA (A:)
    epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
    irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
    

  • Chain 'B':
    No sequence available.