PDB entry 1lcc

View 1lcc on RCSB PDB site
Description: structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
Class: gene regulation/DNA
Keywords: DNA, nmr, half-operator, lac operator, lac repressor, headpiece, gene regulation/DNA complex
Deposited on 1993-03-25, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lac repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lcca_
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*g)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')
    Species: synthetic, synthetic
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lccA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.