PDB entry 1lc3

View 1lc3 on RCSB PDB site
Description: Crystal Structure of a Biliverdin Reductase Enzyme-Cofactor Complex
Class: oxidoreductase
Keywords: Biliverdin Reductase, Tetrapyrrole, Bile Pigment, Bilirubin, Heme, NADH, OXIDOREDUCTASE
Deposited on 2002-04-05, released 2002-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.214
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biliverdin reductase a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46844 (0-End)
      • see remark 999 (0-5)
    Domains in SCOPe 2.07: d1lc3a1, d1lc3a2
  • Heterogens: PO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lc3A (A:)
    mitnsgkfgvvvvgvgragsvrlrdlkdprsaaflnligfvsrrelgsldevrqisleda
    lrsqeidvayicsessshedyirqflqagkhvlveypmtlsfaaaqelwelaaqkgrvlh
    eehvellmeefeflrrevlgkellkgslrftaspleeerfgfpafsgisrltwlvslfge
    lslisatleerkedqymkmtvqletqnkgllswieekgpglkrnryvnfqftsgsleevp
    svgvnkniflkdqdifvqklldqvsaedlaaekkrimhclglasdiqklchqkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lc3A (A:)
    mitnsgkfgvvvvgvgragsvrlrdlkdprsaaflnligfvsrrelgsldevrqisleda
    lrsqeidvayicsessshedyirqflqagkhvlveypmtlsfaaaqelwelaaqkgrvlh
    eehvellmeefeflrrevlgkellkgslrftaspleeerfgfpafsgisrltwlvslfge
    lslisatleerkedqymkmtvqletqnkgllswieekgpglkrnryvnfqftsgsleevp
    svgvnkniflkdqdifvqklldqvsaedlaaekkrimhclglasdiqklchq