PDB entry 1lbl

View 1lbl on RCSB PDB site
Description: Crystal structure of indole-3-glycerol phosphate synthase (IGPS) in complex with 1-(o-carboxyphenylamino)-1-deoxyribulose 5'-phosphate (CdRP)
Class: lyase
Keywords: BETA BARREL, tryptophan biosynthesis, protein ligand complex, substrate complex, LYASE
Deposited on 2002-04-04, released 2002-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: indole-3-glycerol phosphate synthase
  Species: Sulfolobus solfataricus [TaxId:2287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06121 (0-246)
  Domains in SCOPe 2.08: d1lbla_
• Heterogens: 137, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lblA (A:)
  prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
  verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
  aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
  rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
  kikefil