PDB entry 1lbg

View 1lbg on RCSB PDB site
Description: lactose operon repressor bound to 21-base pair symmetric operator DNA, alpha carbons only
Class: transcription/DNA
Keywords: transcription regulation, DNA-binding, repressor, transcription/DNA complex
Deposited on 1996-01-03, released 1996-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4.8 Å
R-factor: 0.26
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lactose operon repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-End)
      • conflict (108)
    Domains in SCOPe 2.07: d1lbga1, d1lbga2
  • Chain 'B':
    Compound: protein (lactose operon repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-End)
      • conflict (108)
    Domains in SCOPe 2.07: d1lbgb1, d1lbgb2
  • Chain 'C':
    Compound: protein (lactose operon repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-End)
      • conflict (108)
    Domains in SCOPe 2.07: d1lbgc1, d1lbgc2
  • Chain 'D':
    Compound: protein (lactose operon repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-End)
      • conflict (108)
    Domains in SCOPe 2.07: d1lbgd1, d1lbgd2
  • Chain 'E':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lbgA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbgA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lbgB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbgB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lbgC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbgC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lbgD (D:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lbgD (D:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.