PDB entry 1lbf

View 1lbf on RCSB PDB site
Description: crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp)
Class: lyase
Keywords: protein ligand complex, beta barrel, tryptophan biosynthesis, substrate analogue complex, LYASE
Deposited on 2002-04-03, released 2002-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.152
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: indole-3-glycerol phosphate synthase
  Species: Sulfolobus solfataricus [TaxId:2287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06121 (0-246)
  Domains in SCOPe 2.08: d1lbfa_
• Heterogens: 137, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lbfA (A:)
  prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
  verdpieyskfmeryavglsilteekyfngsyetlrkiassvsipilmkdfivkesqidd
  aynlgadtvllivkiltereleslleyarsygmeplieindendldialrigarfigins
  rdletleinkenqrklismipsnvvkvaesgiserneieelrklgvnafligsslmrnpe
  kikefil