PDB entry 1lb6

View 1lb6 on RCSB PDB site
Description: TRAF6-CD40 Complex
Class: signaling protein
Keywords: TRAF6-CD40 complex, SIGNALING PROTEIN
Deposited on 2002-04-02, released 2002-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TNF receptor-associated factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: TRAF6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lb6a_
  • Chain 'B':
    Compound: CD40 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD40
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25942 (0-8)
      • conflict (7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1lb6A (A:)
qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany
islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr
npkgfgyvtfmhlealrqrtfikddtllvrcevstrfdle

    Sequence, based on observed residues (ATOM records): (download) 
    >1lb6A (A:)
qqcngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcany
islfvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptipr
npkgfgyvtfmhlealrqrtfikddtllvrcevst

  • Chain 'B':
    No sequence available.