PDB entry 1lav

View 1lav on RCSB PDB site
Description: stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Class: hydrolase
Keywords: hydrolase
Deposited on 1993-05-10, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease H
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7Y4 (0-154)
    • conflict (73)
  Domains in SCOPe 2.08: d1lava_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lavA (A:)
  mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
  ehcevilstdsqylrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
  vkghaghpenercdelaraaamnptledtgyqvev