PDB entry 1lau

View 1lau on RCSB PDB site
Description: uracil-DNA glycosylase
Class: hydrolase/DNA
Keywords: hydrolase, glycosidase, DNA, hydrolase/DNA complex
Deposited on 1996-01-03, released 1996-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: DNA (5'-d(*tp*tp*t)-3')
  • Chain 'E':
    Compound: protein (uracil-DNA glycosylase (e.c.3.2.2.-))
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1laue_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lauE (E:)
    mdltnggvspaatsapldwttfrrvfliddawrplmepelanpltahllaeynrrcqtee
    vlppredvfswtryctpdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaav
    kncypearmsghgclekwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarr
    pglvfmlwgthaqnairpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispi
    dwsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lauE (E:)
    ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
    pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
    kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
    rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv