PDB entry 1lat

View 1lat on RCSB PDB site
Description: glucocorticoid receptor mutant/DNA complex
Class: transcription/DNA
Keywords: glucocorticoid receptor, DNA binding regulatory protein, transcription-DNA complex
Deposited on 1995-12-18, released 1995-12-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glucocorticoid receptor
  Species: Rattus norvegicus [TaxId:10116]
  Gene: NR3C1, GRL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06536 (6-End)
    • expression tag (4-5)
    • engineered mutation (24-25)
    • engineered mutation (28)
    • engineered mutation (43-47)
  Domains in SCOPe 2.05: d1lata_
• Chain 'B':
  Compound: Glucocorticoid receptor
  Species: Rattus norvegicus [TaxId:10116]
  Gene: NR3C1, GRL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06536 (6-End)
    • expression tag (3-5)
    • engineered mutation (24-25)
    • engineered mutation (28)
    • engineered mutation (43-47)
  Domains in SCOPe 2.05: d1latb_
• Chain 'C':
  Compound: DNA (5'-d(*tp*tp*cp*cp*ap*gp*ap*ap*cp*ap*tp*gp*tp*tp*cp*tp*g p*gp*a)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*tp*tp*cp*cp*ap*gp*ap*ap*cp*ap*tp*gp*tp*tp*cp*tp*g p*gp*a)-3')
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1latA (A:)
  mkparpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncp
  acryrkclqagmnlearktkkk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1latA (A:)
  rpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacry
  rkclqagmnle
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1latB (B:)
  mkparpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncp
  acryrkclqagmnlearktkkk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1latB (B:)
  arpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacr
  yrkclqagmnlear
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.