PDB entry 1lat

View 1lat on RCSB PDB site
Description: glucocorticoid receptor mutant/dna complex
Deposited on 1995-12-18, released 1995-12-18
The last revision prior to the SCOP 1.59 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1lata_
  • Chain 'B':
    Domains in SCOP 1.59: d1latb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1latA (A:)
rpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacry
rkclqagmnle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1latB (B:)
arpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacr
yrkclqagmnlear