PDB entry 1lat

View 1lat on RCSB PDB site
Description: glucocorticoid receptor mutant/DNA complex
Class: transcription/DNA
Keywords: glucocorticoid receptor, DNA binding regulatory protein, transcription-DNA complex
Deposited on 1995-12-18, released 1995-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (6-End)
      • expression tag (4-5)
      • engineered mutation (24-25)
      • engineered mutation (28)
      • engineered mutation (43-47)
    Domains in SCOPe 2.08: d1lata1, d1lata2
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (6-End)
      • expression tag (3-5)
      • engineered mutation (24-25)
      • engineered mutation (28)
      • engineered mutation (43-47)
    Domains in SCOPe 2.08: d1latb1, d1latb2
  • Chain 'C':
    Compound: DNA (5'-d(*tp*tp*cp*cp*ap*gp*ap*ap*cp*ap*tp*gp*tp*tp*cp*tp*g p*gp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*tp*cp*cp*ap*gp*ap*ap*cp*ap*tp*gp*tp*tp*cp*tp*g p*gp*a)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1latA (A:)
    mkparpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncp
    acryrkclqagmnlearktkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1latA (A:)
    rpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacry
    rkclqagmnle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1latB (B:)
    mkparpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncp
    acryrkclqagmnlearktkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1latB (B:)
    arpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacr
    yrkclqagmnlear
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.