PDB entry 1laj

View 1laj on RCSB PDB site
Description: The Structure of Tomato Aspermy Virus by X-Ray Crystallography
Class: Virus/RNA
Keywords: anti-parallel beta sheets, jelly roll, T=3 icosahedral virus, protein-RNA complex, disulphide bridge, Icosahedral virus, Virus/RNA COMPLEX
Deposited on 2002-03-28, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.218
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Tomato aspermy virus [TaxId:12315]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1laja_
  • Chain 'B':
    Compound: capsid protein
    Species: Tomato aspermy virus [TaxId:12315]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lajb_
  • Chain 'C':
    Compound: capsid protein
    Species: Tomato aspermy virus [TaxId:12315]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lajc_
  • Chain 'R':
    Compound: 5'-r(*ap*ap*a)-3'
  • Heterogens: PO4, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lajA (A:)
    maqngtgggsrrprrgrrnnnnnnstardkallaltqqvnrlaniasssapslqhptfia
    skkcragytytsldvrptrtekdksfgqrliipvpvseypkkkvscvqvrlnpspkfnst
    iwvslrrldettlltsenvfklftdglavliyqhvptgiqpnnkitfdmsnvgaeigdmg
    kyalivyskddvleademvihidiehqripsastlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lajA (A:)
    niasssapslqhptfiaskkcragytytsldvrptrtekdksfgqrliipvpvseypkkk
    vscvqvrlnpspkfnstiwvslrrldettlltsenvfklftdglavliyqhvptgiqpnn
    kitfdmsnvgaeigdmgkyalivyskddvleademvihidiehqripsastlpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lajB (B:)
    maqngtgggsrrprrgrrnnnnnnstardkallaltqqvnrlaniasssapslqhptfia
    skkcragytytsldvrptrtekdksfgqrliipvpvseypkkkvscvqvrlnpspkfnst
    iwvslrrldettlltsenvfklftdglavliyqhvptgiqpnnkitfdmsnvgaeigdmg
    kyalivyskddvleademvihidiehqripsastlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lajB (B:)
    tqqvnrlaniasssapslqhptfiaskkcragytytsldvrptrtekdksfgqrliipvp
    vseypkkkvscvqvrlnpspkfnstiwvslrrldettlltsenvfklftdglavliyqhv
    ptgiqpnnkitfdmsnvgaeigdmgkyalivyskddvleademvihidiehqripsastl
    pv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lajC (C:)
    maqngtgggsrrprrgrrnnnnnnstardkallaltqqvnrlaniasssapslqhptfia
    skkcragytytsldvrptrtekdksfgqrliipvpvseypkkkvscvqvrlnpspkfnst
    iwvslrrldettlltsenvfklftdglavliyqhvptgiqpnnkitfdmsnvgaeigdmg
    kyalivyskddvleademvihidiehqripsastlpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lajC (C:)
    altqqvnrlaniasssapslqhptfiaskkcragytytsldvrptrtekdksfgqrliip
    vpvseypkkkvscvqvrlnpspkfnstiwvslrrldettlltsenvfklftdglavliyq
    hvptgiqpnnkitfdmsnvgaeigdmgkyalivyskddvleademvihidiehqripsas
    tlpv
    

  • Chain 'R':
    No sequence available.