PDB entry 1lac

View 1lac on RCSB PDB site
Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex
Class: transferase (acyltransferase)
Keywords: transferase (acyltransferase)
Deposited on 1992-09-02, released 1993-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 1994-10-15, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide acetyltransferase
    Species: Bacillus stearothermophilus
    Gene: BACILLUS STEAROTHERMOPHILUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1laca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lacA (A:)
afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
pegtvatvgqtlitldapgy