PDB entry 1lac

View 1lac on RCSB PDB site
Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex
Deposited on 1992-09-02, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lac__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lac_ (-)
    afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
    pegtvatvgqtlitldapgy