PDB entry 1laa

View 1laa on RCSB PDB site
Description:
Deposited on 1992-06-24, released 1993-01-15
The last revision prior to the SCOP 1.63 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.77 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1laa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1laa_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrsteygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv