PDB entry 1la6

View 1la6 on RCSB PDB site
Description: The crystal structure of Trematomus newnesi hemoglobin in a partial hemichrome state
Class: oxygen storage/transport
Keywords: Hemichrome, bishistidine complex, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2002-03-28, released 2002-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha-1 chain
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1la6a_
  • Chain 'B':
    Compound: Hemoglobin beta-1/2 chain
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1la6b_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1la6A (A:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1la6B (B:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
    aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflaavvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la6B (B:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfimsnanvaahgikvlhgl
    drgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmghaftaetqgafq
    kflaavvsalgk