PDB entry 1la3

View 1la3 on RCSB PDB site
Description: solution structure of recoverin mutant, e85q
Deposited on 2002-03-27, released 2002-06-19
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1la3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1la3A (A:)
    gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkqyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfe