PDB entry 1la2

View 1la2 on RCSB PDB site
Description: Structural analysis of Saccharomyces cerevisiae myo-inositol phosphate synthase
Deposited on 2002-03-27, released 2002-04-10
The last revision prior to the SCOP 1.65 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1la2A (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2A (A:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1la2B (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2B (B:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1la2C (C:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2C (C:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1la2D (D:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2D (D:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll