PDB entry 1la2

View 1la2 on RCSB PDB site
Description: Structural analysis of Saccharomyces cerevisiae myo-inositol phosphate synthase
Class: isomerase
Keywords: structural genomics, inositol, metabolism, yeast, ino1, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2002-03-27, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol-1-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: INO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • modified residue (68)
      • see remark 999 (97)
      • modified residue (108)
      • modified residue (135)
      • see remark 999 (139-140)
      • modified residue (157)
      • modified residue (175)
      • see remark 999 (200)
      • modified residue (260)
      • modified residue (404)
      • modified residue (414)
      • modified residue (422)
      • see remark 999 (443)
      • modified residue (451)
    Domains in SCOPe 2.07: d1la2a1, d1la2a2
  • Chain 'B':
    Compound: myo-inositol-1-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: INO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • modified residue (68)
      • see remark 999 (97)
      • modified residue (108)
      • modified residue (135)
      • see remark 999 (139-140)
      • modified residue (157)
      • modified residue (175)
      • see remark 999 (200)
      • modified residue (260)
      • modified residue (404)
      • modified residue (414)
      • modified residue (422)
      • see remark 999 (443)
      • modified residue (451)
    Domains in SCOPe 2.07: d1la2b1, d1la2b2
  • Chain 'C':
    Compound: myo-inositol-1-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: INO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • modified residue (68)
      • see remark 999 (97)
      • modified residue (108)
      • modified residue (135)
      • see remark 999 (139-140)
      • modified residue (157)
      • modified residue (175)
      • see remark 999 (200)
      • modified residue (260)
      • modified residue (404)
      • modified residue (414)
      • modified residue (422)
      • see remark 999 (443)
      • modified residue (451)
    Domains in SCOPe 2.07: d1la2c1, d1la2c2
  • Chain 'D':
    Compound: myo-inositol-1-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: INO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11986 (Start-532)
      • see remark 999 (13)
      • see remark 999 (59)
      • modified residue (68)
      • see remark 999 (97)
      • modified residue (108)
      • modified residue (135)
      • see remark 999 (139-140)
      • modified residue (157)
      • modified residue (175)
      • see remark 999 (200)
      • modified residue (260)
      • modified residue (404)
      • modified residue (414)
      • modified residue (422)
      • see remark 999 (443)
      • modified residue (451)
    Domains in SCOPe 2.07: d1la2d1, d1la2d2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1la2A (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2A (A:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1la2B (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2B (B:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1la2C (C:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2C (C:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1la2D (D:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1la2D (D:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapksvidd
    iiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvceds
    llatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywlkapltrpgfhp
    vnglnkqrtalenflrlliglpsqnelrfeerll