PDB entry 1la0

View 1la0 on RCSB PDB site
Description: Solution Structure of Calcium Saturated Cardiac Troponin C in the Troponin C-Troponin I Complex
Class: contractile protein
Keywords: EF-hand, troponin, CONTRACTILE PROTEIN
Deposited on 2002-03-27, released 2002-12-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1la0a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1la0A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkddskgkteeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve