PDB entry 1l9u

View 1l9u on RCSB PDB site
Description: thermus aquaticus RNA polymerase holoenzyme at 4 a resolution
Class: transcription
Keywords: helix-turn-helix, coiled-coil
Deposited on 2002-03-26, released 2002-05-22
The last revision prior to the SCOP 1.73 freeze date was dated 2002-05-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase, alpha subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9ua_
  • Chain 'B':
    Compound: RNA polymerase, alpha subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9ub_
  • Chain 'C':
    Compound: RNA polymerase, beta subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9uc_
  • Chain 'D':
    Compound: RNA polymerase, beta-prime subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9ud_
  • Chain 'E':
    Compound: RNA polymerase, omega subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9ue_
  • Chain 'H':
    Compound: sigma factor sigA
    Species: Thermus aquaticus
    Gene: rpoD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9uh_
  • Chain 'J':
    Compound: RNA polymerase, alpha subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9uj_
  • Chain 'K':
    Compound: RNA polymerase, alpha subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9uk_
  • Chain 'L':
    Compound: RNA polymerase, beta subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9ul_
  • Chain 'M':
    Compound: RNA polymerase, beta-prime subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9um_
  • Chain 'N':
    Compound: RNA polymerase, omega subunit
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9un_
  • Chain 'Q':
    Compound: sigma factor sigA
    Species: Thermus aquaticus
    Gene: rpoD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l9uq_
  • Heterogens: MG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l9uA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l9uB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uB (B:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l9uC (C:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpas
    eegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgper
    itrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgek
    ardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklan
    rhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqry
    ispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspee
    qlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqpl
    ggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsv
    pesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uC (C:)
    eikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieeglvld
    fleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplmtedgsf
    iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgvvtmkvn
    krkfplvlllrvlgydqetlvrelsglldeavlamrpeeamvrlftllrpglaylfglla
    dpkrydlgeagrykaeeklgvglsgrtlvfkdevflptlrylfaltagvpghevddidhl
    gnrrirtvgelmadqfrvglarlargvrermvmgspdtltpaklvnsrpleaalreffsr
    sqlsqfkdetnplsslrhkrrisalgpggltreragfdvrdvhrthygricpvetpegan
    iglitslaayarvdalgfirtpyrrvkngvvteevvymtaseedrytiaqantplegdri
    atdrvvarrrgepvivapeevefmdvspkqvfslntnlipflehddanralmgsnmqtqa
    vpliraqapvvmtgleervvrdslaalyaeedgevvkvdgtriavryedgrlvhplrrya
    rsnqgtafdqrprvrvgqrvdlladgpaseegflalgqnvlvaimpfdgynfedaivise
    ellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegivrigaevkpg
    dilvgrtsfkgeqepspeerllrsifgekardvkdtslrvppgeggivvgrlrlrrgdpg
    velkpgvrevvrvfvaqkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdviln
    plgvpsrmnlgqilethlglagyflgqryispvfdgatepeikellaeafnlyfgkrqge
    gfgvdkrekevlaraeklglvspgkspeeqlkelfdlgkvvlydgrtgepfegpivvgqm
    fimklyhmvedkmharstgpyslitqqplggkaqfggqrfgemevwaleaygaahtlqem
    ltiksddiegrnaayqaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdif
    egla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l9uD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvk
    dgeevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpge
    vlaelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivev
    gqplaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegak
    vqagekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdv
    ladggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlk
    fvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeli
    qmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeek
    qryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdi
    esglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtditqglprvi
    elfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyve
    agqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyve
    vtdpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieeark
    eaveakekeaprrpvrreqpgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uD (D:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfnkyivldpkgavldgvpvekrqlltdeedarmgaeaiqellkeldleklerel
    leemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfat
    sdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgse
    rplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfl
    lkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafq
    pvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgep
    lakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvg
    rlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaq
    eliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavip
    eekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypf
    nplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshga
    rkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkr
    sdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtr
    ygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtprvielfearrpkakav
    iseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidph
    qlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegq
    vlekwdvealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkk
    deliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieear
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l9uE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
    twamkelltgrlffgenlvpedrlqkemerly
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l9uH (H:)
    tsdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakil
    gtarveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfld
    liqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinkl
    srtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygd
    fipdenlpspveaaaqsllseelekalsklsereamvlklrkglidgrehtleevgayfg
    vtrerirqienkalrklkyhesrtrklrdfle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uH (H:)
    sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
    tarveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldl
    iqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinkls
    rtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpidfipdenlpsp
    veaaaqsllseelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqie
    nkalrklkyhesrtrklrdfle
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1l9uJ (J:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uJ (J:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1l9uK (K:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uK (K:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1l9uL (L:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpas
    eegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgper
    itrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgek
    ardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklan
    rhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqry
    ispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspee
    qlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqpl
    ggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsv
    pesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uL (L:)
    eikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieeglvld
    fleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplmtedgsf
    iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgvvtmkvn
    krkfplvlllrvlgydqetlvrelsglldeavlamrpeeamvrlftllrpglaylfglla
    dpkrydlgeagrykaeeklgvglsgrtlvfkdevflptlrylfaltagvpghevddidhl
    gnrrirtvgelmadqfrvglarlargvrermvmgspdtltpaklvnsrpleaalreffsr
    sqlsqfkdetnplsslrhkrrisalgpggltreragfdvrdvhrthygricpvetpegan
    iglitslaayarvdalgfirtpyrrvkngvvteevvymtaseedrytiaqantplegdri
    atdrvvarrrgepvivapeevefmdvspkqvfslntnlipflehddanralmgsnmqtqa
    vpliraqapvvmtgleervvrdslaalyaeedgevvkvdgtriavryedgrlvhplrrya
    rsnqgtafdqrprvrvgqrvdlladgpaseegflalgqnvlvaimpfdgynfedaivise
    ellkrdfytsihieryeieardtklgperitrdiphlseaalrdldeegivrigaevkpg
    dilvgrtsfkgeqepspeerllrsifgekardvkdtslrvppgeggivvgrlrlrrgdpg
    velkpgvrevvrvfvaqkrklqvgdklanrhgnkgvvakilpvedmphlpdgtpvdviln
    plgvpsrmnlgqilethlglagyflgqryispvfdgatepeikellaeafnlyfgkrqge
    gfgvdkrekevlaraeklglvspgkspeeqlkelfdlgkvvlydgrtgepfegpivvgqm
    fimklyhmvedkmharstgpyslitqqplggkaqfggqrfgemevwaleaygaahtlqem
    ltiksddiegrnaayqaiikgedvpepsvpesfrvlvkelqalaldvqtldekdnpvdif
    egla
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1l9uM (M:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvk
    dgeevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpge
    vlaelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivev
    gqplaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegak
    vqagekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdv
    ladggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlk
    fvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeli
    qmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeek
    qryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdi
    esglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtditqglprvi
    elfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyve
    agqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyve
    vtdpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieeark
    eaveakekeaprrpvrreqpgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uM (M:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfnkyivldpkgavldgvpvekrqlltdeedarmgaeaiqellkeldleklerel
    leemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfat
    sdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgse
    rplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfl
    lkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafq
    pvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgep
    lakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvg
    rlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaq
    eliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavip
    eekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypf
    nplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshga
    rkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkr
    sdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtr
    ygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtprvielfearrpkakav
    iseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidph
    qlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegq
    vlekwdvealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkk
    deliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieear
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1l9uN (N:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uN (N:)
    aepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpnav
    twamkelltgrlffgenlvpedrlqkemerly
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1l9uQ (Q:)
    tsdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakil
    gtarveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfld
    liqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinkl
    srtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpigdekdsfygd
    fipdenlpspveaaaqsllseelekalsklsereamvlklrkglidgrehtleevgayfg
    vtrerirqienkalrklkyhesrtrklrdfle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l9uQ (Q:)
    sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
    tarveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvsiakkytgrglsfldl
    iqegnqgliravekfeykrrfkfstyatwwirqainraiadqartiripvhmvetinkls
    rtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsletpidfipdenlpsp
    veaaaqsllseelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqie
    nkalrklkyhesrtrklrdfle