PDB entry 1l9l

View 1l9l on RCSB PDB site
Description: granulysin from human cytolytic t lymphocytes
Class: antimicrobial protein
Keywords: granulysin, saposin fold, membrane-lytic, antimicrobial protein
Deposited on 2002-03-25, released 2002-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.138
AEROSPACI score: 1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Granulysin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l9la_
  • Heterogens: SO4, MPO, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9lA (A:)
    grdyrtcltivqklkkmvdkptqrsvsnaatrvcrtgrsrwrdvcrnfmrryqsrviqgl
    vagetaqqicedlr