PDB entry 1l9a

View 1l9a on RCSB PDB site
Description: crystal structure of srp19 in complex with the s domain of signal recognition particle RNA
Class: signaling protein/RNA
Keywords: protein-RNA complex, ribonucleoprotein, srp, signal recognition particle, tetraloop, signaling protein/RNA complex
Deposited on 2002-03-22, released 2002-06-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.264
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 19 kda protein
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: SRP19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58440 (0-86)
      • engineered (60)
      • engineered (62)
      • engineered (73)
      • engineered (79)
    Domains in SCOPe 2.03: d1l9aa_
  • Chain 'B':
    Compound: signal recognition particle RNA S domain
    Species: synthetic, synthetic
  • Heterogens: MG, MMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9aA (A:)
    miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
    agrvevdykgnklcllkeiakiikgkn
    

  • Chain 'B':
    No sequence available.