PDB entry 1l9a

View 1l9a on RCSB PDB site
Description: crystal structure of srp19 in complex with the s domain of signal recognition particle rna
Deposited on 2002-03-22, released 2002-06-28
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.264
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1l9aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l9aA (A:)
    miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
    agrvevdykgnklcllkeiakiikgkn