PDB entry 1l99

View 1l99 on RCSB PDB site
Description: perturbation of trp 138 in t4 lysozyme by mutations at gln 105 used to correlate changes in structure, stability, solvation, and spectroscopic properties
Deposited on 1992-07-13, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.168
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1l99__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l99_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfgmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl