PDB entry 1l90

View 1l90 on RCSB PDB site
Description: similar hydrophobic replacements of leu 99 and phe 153 within the core of t4 lysozyme have different structural and thermodynamic consequences
Deposited on 1992-01-21, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.75 Å
R-factor: 0.156
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1l90__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l90_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk