PDB entry 1l8z

View 1l8z on RCSB PDB site
Description: solution structure of hmg box 5 in human upstream binding factor
Deposited on 2002-03-22, released 2002-06-05
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1l8za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1l8zA (A:)
mgklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaed
qkryerelsemrappaatnsskklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1l8zA (A:)
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskkle