PDB entry 1l8z

View 1l8z on RCSB PDB site
Description: solution structure of hmg box 5 in human upstream binding factor
Deposited on 2002-03-22, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1l8za_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l8zA (A:)
  gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
  kryerelsemrappaatnsskkle