PDB entry 1l8z

View 1l8z on RCSB PDB site
Description: Solution structure of HMG box 5 in human upstream binding factor
Class: DNA binding protein
Keywords: hUBF, HMG box 5, DNA binding domain, DNA BINDING PROTEIN
Deposited on 2002-03-22, released 2002-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Upstream binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSUBF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17480 (1-82)
      • expression tag (83-84)
    Domains in SCOPe 2.08: d1l8za1, d1l8za2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1l8zA (A:)
mgklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaed
qkryerelsemrappaatnsskklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1l8zA (A:)
gklpespkraeeiwqqsvigdylarfkndrvkalkamemtwnnmekkeklmwikkaaedq
kryerelsemrappaatnsskkle