PDB entry 1l8s

View 1l8s on RCSB PDB site
Description: CARBOXYLIC ESTER HYDROLASE COMPLEX (DIMERIC PLA2 + LPC-ether + ACETATE + PHOSPHATE IONS)
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase, dimer, paf hydrolysis products binding, phosphate binding
Deposited on 2002-03-21, released 2002-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.187
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l8sa_
  • Chain 'B':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l8sb_
  • Heterogens: CA, NA, PO4, ACT, LPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8sA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8sB (B:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc