PDB entry 1l8r

View 1l8r on RCSB PDB site
Description: Structure of the Retinal Determination Protein Dachshund Reveals a DNA-Binding Motif
Class: transcription
Keywords: winged-helix, TRANSCRIPTION
Deposited on 2002-03-21, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.237
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dachshund
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UI36 (2-100)
      • cloning artifact (0-1)
      • modified residue (8)
    Domains in SCOPe 2.07: d1l8ra1, d1l8ra2
  • Chain 'B':
    Compound: Dachshund
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UI36 (2-100)
      • modified residue (8)
    Domains in SCOPe 2.07: d1l8rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l8rA (A:)
    gsqnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpv
    vcnveqvrilrglgaiqpgvnrcklisrkdfetlyndctna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l8rB (B:)
    gsqnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpv
    vcnveqvrilrglgaiqpgvnrcklisrkdfetlyndctna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8rB (B:)
    qnneckmvdlrgakvasftvegceliclpqafdlflkhlvgglhtvytklkrleitpvvc
    nveqvrilrglgaiqpgvnrcklisrkdfetlyndctna