PDB entry 1l8q

View 1l8q on RCSB PDB site
Description: crystal structure of dna replication initiation factor
Deposited on 2002-03-21, released 2002-09-25
The last revision prior to the SCOP 1.71 freeze date was dated 2002-09-25, with a file datestamp of 2002-09-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8qA (A:)
    kdflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagne
    akkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqief
    fhifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklk
    efnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvany
    yavkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsvee
    ekkkdrkfkhlvgflekqafdkic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8qA (A:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveee
    kkrkfkhlvgflekqafdkic