PDB entry 1l8q

View 1l8q on RCSB PDB site
Description: crystal structure of DNA replication initiation factor
Class: DNA binding protein
Keywords: aaa+, helix-turn-helix, nucleotide-binding, DNA binding, replication initiation, DNA binding protein
Deposited on 2002-03-21, released 2002-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosomal replication initiator protein dnaA
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: dnaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66659 (Start-323)
      • modified residue (79)
      • modified residue (94)
      • modified residue (230)
      • modified residue (264)
    Domains in SCOPe 2.07: d1l8qa1, d1l8qa2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8qA (A:)
    kdflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagne
    akkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqief
    fhifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklk
    efnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvany
    yavkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsvee
    ekkkdrkfkhlvgflekqafdkic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8qA (A:)
    dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
    kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
    hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
    fnlelrkevidyllentknvreiegkikliklkgfeglerkerkerdklmqivefvanyy
    avkvedilsdkrnkrtsearkiamylcrkvcsaslieiarafkrkdhttvihairsveee
    kkrkfkhlvgflekqafdkic