PDB entry 1l8n

View 1l8n on RCSB PDB site
Description: the 1.5a crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-1, complexed with 4-o-methyl-glucuronic acid and xylotriose
Deposited on 2002-03-21, released 2003-03-21
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.139
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8nA (A:)
    mtagyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqev
    netansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfh
    flrllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqri
    kdyarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyas
    pieigglptadpldpevrwwwketakriyqyipdfggfvvkadsefrpgpftygrdhaeg
    anmlaealapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikn
    gpmdfqvrepvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgk
    gsevkkvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeia
    newvvqtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshw
    gtyhyadrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhs
    getviqhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvin
    tyfyrksgiddqygrkiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8nA (A:)
    gyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevnet
    ansiwlgtledeeferplegtlvhpegyvirsdvdpfriyiigktdagvlygvfhflrll
    qmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvnqrikdyarll
    asvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyaspieiggl
    ptadpldpevrwwwketakriyqyipdfggfvvkadsefrpgpftygrdhaeganmlaea
    lapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqv
    repvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkv
    idgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqt
    fgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyad
    rdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqh
    iynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrks
    giddqygrkiy