PDB entry 1l8k

View 1l8k on RCSB PDB site
Description: T Cell Protein-Tyrosine Phosphatase Structure
Deposited on 2002-03-21, released 2002-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1l8ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8kA (A:)
    mpttierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvk
    lqnaendyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekes
    vkcaqywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttw
    pdfgvpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlmekgd
    dinikqvllnmrkyrmgliqtpdqlrfsymaiiegakcikgdssiqkrwkelskedlspa
    fdhspnkimtekyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8kA (A:)
    ierefeeldtqrrwqplyleirneshdyphrvakfpenrnrnryrdvspydhsrvklqna
    endyinaslvdieeaqrsyiltqgplpntcchfwlmvwqqktkavvmlnrivekesvkca
    qywptddqemlfketgfsvkllsedvksyytvhllqleninsgetrtishfhyttwpdfg
    vpespasflnflfkvresgslnpdhgpavihcsagigrsgtfslvdtclvlmekgddini
    kqvllnmrkyrmgliqtpdqlrfsymaiiegak