PDB entry 1l8i

View 1l8i on RCSB PDB site
Description: Dna Protection and Binding by E. Coli DPS Protein
Deposited on 2002-03-20, released 2003-06-24
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1l8ia_
  • Chain 'B':
    Domains in SCOP 1.69: d1l8ib_
  • Chain 'C':
    Domains in SCOP 1.69: d1l8ic_
  • Chain 'D':
    Domains in SCOP 1.69: d1l8id_
  • Chain 'E':
    Domains in SCOP 1.69: d1l8ie_
  • Chain 'F':
    Domains in SCOP 1.69: d1l8if_
  • Chain 'G':
    Domains in SCOP 1.69: d1l8ig_
  • Chain 'H':
    Domains in SCOP 1.69: d1l8ih_
  • Chain 'I':
    Domains in SCOP 1.69: d1l8ii_
  • Chain 'J':
    Domains in SCOP 1.69: d1l8ij_
  • Chain 'K':
    Domains in SCOP 1.69: d1l8ik_
  • Chain 'L':
    Domains in SCOP 1.69: d1l8il_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8iA (A:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iA (A:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l8iB (B:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iB (B:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l8iC (C:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iC (C:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l8iD (D:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iD (D:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l8iE (E:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iE (E:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l8iF (F:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iF (F:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1l8iG (G:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iG (G:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l8iH (H:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iH (H:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1l8iI (I:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iI (I:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1l8iJ (J:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iJ (J:)
    atnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfr
    talichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivan
    dvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1l8iK (K:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iK (K:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1l8iL (L:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8iL (L:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie