PDB entry 1l8h

View 1l8h on RCSB PDB site
Description: DNA protection and binding by e. coli dps protein
Class: DNA binding protein
Keywords: dodecamer, metal bound complex, DNA binding protein
Deposited on 2002-03-20, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.21
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8ha_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hb_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hc_
  • Chain 'D':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hd_
  • Chain 'E':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8he_
  • Chain 'F':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hf_
  • Chain 'G':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hg_
  • Chain 'H':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hh_
  • Chain 'I':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hi_
  • Chain 'J':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hj_
  • Chain 'K':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hk_
  • Chain 'L':
    Compound: DNA protection during starvation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABT2 (Start-166)
      • engineered (74)
      • engineered (77)
    Domains in SCOPe 2.06: d1l8hl_
  • Heterogens: K, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8hA (A:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hA (A:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l8hB (B:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hB (B:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l8hC (C:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hC (C:)
    katnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgf
    rtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaiva
    ndvrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l8hD (D:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hD (D:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l8hE (E:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hE (E:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l8hF (F:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hF (F:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1l8hG (G:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hG (G:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l8hH (H:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hH (H:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1l8hI (I:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hI (I:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1l8hJ (J:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hJ (J:)
    tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
    alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
    vrkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1l8hK (K:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hK (K:)
    nllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
    lichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandv
    rkaigeakdddtadiltaasrdldkflwfiesnie
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1l8hL (L:)
    mstaklvkskatnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfi
    avhemldgfrtalichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlke
    ladryaivandvrkaigeakdddtadiltaasrdldkflwfiesnie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8hL (L:)
    llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
    ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
    kaigeakdddtadiltaasrdldkflwfiesnie