PDB entry 1l8c

View 1l8c on RCSB PDB site
Description: structural basis for hif-1alpha/cbp recognition in the cellular hypoxic response
Class: gene regulation
Keywords: gene regulation
Deposited on 2002-03-19, released 2002-04-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45481 (0-94)
      • see remark 999 (55)
    Domains in SCOPe 2.05: d1l8ca_
  • Chain 'B':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1l8cb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l8cA (A:)
adpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqagkacq
vahcassrqiishwknctrhdcpvclplknasdkr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l8cB (B:)
sdlacrllgqsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn