PDB entry 1l8c

View 1l8c on RCSB PDB site
Description: structural basis for hif-1alpha/cbp recognition in the cellular hypoxic response
Deposited on 2002-03-19, released 2002-04-10
The last revision prior to the SCOP 1.65 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1l8ca_
  • Chain 'B':
    Domains in SCOP 1.65: d1l8cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l8cA (A:)
adpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqagkacq
vahcassrqiishwknctrhdcpvclplknasdkr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l8cB (B:)
sdlacrllgqsmdesglpqltsydcevnapiqgsrnllqgeellraldqvn