PDB entry 1l8a

View 1l8a on RCSB PDB site
Description: e. coli pyruvate dehydrogenase
Class: oxidoreductase
Keywords: thiamin diphosphate, pyruvate, alpha-keto acid dehydrogenase, oxidoreductase
Deposited on 2002-03-19, released 2002-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l8aa1, d1l8aa2, d1l8aa3
  • Chain 'B':
    Compound: Pyruvate dehydrogenase E1 component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1l8ab1, d1l8ab2, d1l8ab3
  • Heterogens: MG, TDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l8aA (A:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8aA (A:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginelgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l8aB (B:)
    serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
    ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
    fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
    klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
    aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
    llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
    rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmdgvrhi
    rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
    fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
    ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
    mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
    ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
    gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
    etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
    fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l8aB (B:)
    isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
    iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
    syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
    peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
    srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
    iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
    sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqdfgalleeq
    skeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiyspedekgqil
    qeginelgagcswlaaatsystnnlpmipfyiyysmfgfqrigdlcwaagdqqargflig
    gtsgrttlngeglqhedghshiqsltipncisydpayayevavimhdglermygekqenv
    yyyittlnenyhmpampegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeil
    akdygvgsdvysvtsftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymk
    lfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkk
    vvadaiakfnidadkvnprla