PDB entry 1l7t

View 1l7t on RCSB PDB site
Description: Crystal Structure Analysis of the anti-testosterone Fab fragment
Class: immune system
Keywords: anti-testosterone, fab fragment, affinity and specificity matured, IMMUNE SYSTEM
Deposited on 2002-03-17, released 2002-10-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-testosterone (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l7th1, d1l7th2
  • Chain 'L':
    Compound: anti-testosterone (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l7tl1, d1l7tl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1l7tH (H:)
    evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7tH (H:)
    evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7tL (L:)
    dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
    pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrdec