PDB entry 1l7s

View 1l7s on RCSB PDB site
Description:
Deposited on 2002-03-17, released 2002-10-02
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l7sh1, d1l7sh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1l7sl1, d1l7sl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7sH (H:)
    evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
    gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l7sL (L:)
    dvvvtqtplslpvslgdqasiscrssevivtrngytpiewylqkpgqspklliykaykrf
    pgvpdrfsgsgsgtdftlkisrveaedlgvyycfdgstvppkfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrdec